WWW::PDB Perl interface to the Protein Data Bank
Download

WWW::PDB Ranking & Summary

WWW::PDB Tags

Perl module interface perl pdb Perl interface Protein Data Bank

WWW::PDB Description

Perl interface to the Protein Data Bank The Protein Data Bank (PDB) was established in 1971 as a repository of the atomic coordinates of protein structures (Bernstein et al., 1997). It has since outgrown that role, proving invaluable not only to the research community but also to students and educators (Berman et al., 2002).WWW::PDB is a Perl module designed as an interface to the Protein Data Bank. It provides functions for retrieving files, optionally caching them locally. Additionally, it wraps the functionality of the PDB's SOAP web services.SYNOPSIS use WWW::PDB qw(:all); # set directory for caching downloads WWW::PDB->cache('/foo/bar'); my $fh = get_structure('2ili'); print while ; my @pdbids = WWW::PDB->keyword_query('carbonic anhydrase'); for(@pdbids) { my $citation = WWW::PDB->get_primary_citation_title($_), my @chains = WWW::PDB->get_chains($_); printf("%s %s ", $_, $citation, join(', ', @chains)); } my $seq = q( VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTK TYFPHFDLSHGSAQVKGHGKKVADALTAVAHVDDMPNAL ); print WWW::PDB->blast($seq, 10.0, 'BLOSUM62', 'HTML'); Requirements: · Perl

WWW::PDB Related Software